5W6GH

Human antibody 6649 in complex with influenza hemagglutinin h1 solomon islands
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
225
structure length
225
Chain Sequence
QVQLQESGPGLVKTSETLSLTCTVSGGSIKNKDFFWAWIRQPPGKALEWIGSVFYSGGAYYNWSLRNRVTMSADTSKNQFSLKMTSVTASDTSFYYCATSYVDNWHAGLHWFDSWGRGTLVTVSGASTKGPSVFPLAPSSKSTSGGTVALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1
publication title Conserved epitope on influenza-virus hemagglutinin head defined by a vaccine-induced antibody.
pubmed doi rcsb
source organism Influenza a virus (a/solomon islands/3/2006(h1n1))
total genus 49
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2017-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...