5WQZA

Solution structure of a histone binding domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
124
Chain Sequence
MSQNRQLLYPREEMVSLVRSLDRPQENGLFSQDVLLQYPELAESYTKVCPNRCDLATAADRAAKGAYGYDVQLTTLKEDIRLMVNNCILFNGAEGAYADAARTFEKFAMGKIDAYISQKVGGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure Of A Histone Binding Domain
rcsb
molecule tags Protein binding
source organism Trypanosoma brucei brucei (strain 927/4 gutat10.1)
molecule keywords Putative uncharacterized protein
total genus 28
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...