5WSYA

The complex structure of sav606 with n-carboxymethyl-3-aminobutyrate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
171
structure length
161
Chain Sequence
MTTAQHPTDEDLLARVLVPYKDHCKYLRSAVVTESAVARCEFAIPESCYIDDTGHLNSVEVNICYNQMMYYLVAKSVKEGLLAGFESWTLDDFWKHQLPDILIARFASNFRRPVNPRAFSGEMEFQSVTRRAFLHAETAYRYWDADSGRCDGEAVLAFVNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the dual-function thioesterase SAV606 unravels the mechanism of Michael addition of glycine to an alpha , beta-unsaturated thioester.
pubmed doi rcsb
molecule tags Hydrolase
source organism Streptomyces avermitilis (strain atcc 31267 / dsm 46492 / jcm 5070 / nbrc 14893
molecule keywords Uncharacterized protein
total genus 40
structure length 161
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10862 FcoT FcoT-like thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...