5WTTA

Structure of the 093g9 fab in complex with the epitope peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
216
Chain Sequence
DVQLQESGPDLVKPSQSPSLTCTVTGYSITSDYSWHWIRQFPGDKLEWMGYIHYSGSTNYNPSLKSRISITRDTSKNQFFLQLSSVTIEDTATYYCARGTIYEGSLDYWGQGTTLTVSSAKTTPPSVYPLAPGNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the recognition of CCN1 by monoclonal antibody 093G9.
pubmed doi rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Heavy chain of 093G9 Fab
total genus 43
structure length 216
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-12-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...