5WYJBD

Cryo-em structure of the 90s small subunit pre-ribosome (dhr1-depleted, enp1-tap, state 1)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
357
structure length
325
Chain Sequence
IVRLKDANASHPSHSAIQSLSFHPSKPLLLTGGYDKTLRIYHIDGKTNHLVTSLHLVGSPIQTCTFYTSLSNQNQQNIFTAGRRRYMHSWDLSQTAKIEKFSRLYGHESTQRSFENFKVAHLQNSQTNSVHGWINILHSTSGLWLMGCKIEGVITDFCIDYQPISRGKFRTILIAVNAYGEVWEFDLNKNGHVIRRWKDQGGVGITKIQVGGNRWLAVGSESGFVNLYDRNNAMTSSTPTPVAALDQLTTTISNLQFSPDGQILCMASRAVKDALRLVHLPSCSVFSNWPTSGTPLGKVTSVAFSPSGGLLAVGNEQGKVRLWKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular architecture of the 90S small subunit pre-ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords U3 RNA
total genus 35
structure length 325
sequence length 357
ec nomenclature
pdb deposition date 2017-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
BD PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...