5X5IA

The x-ray crystal structure of a tetr family transcription regulator rcda involved in the regulation of biofilm formation in escherichia coli
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
174
structure length
169
Chain Sequence
RREKIIQATLEAVKLYGIHAVTHRKIATLASMTYYFSGIDELLLEAFSSFTEIMSRQYQAFFSDVSDAPGACQAITDMIYSSQVATPDNMELMYQLYALASRKPLLKTVMQNWMQRSQQTLEQWFEPGTARALDAFIEGMTLHFVTDRKPLSREEILRMVERVAGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator RcdA
publication title A structural sketch of RcdA, a transcription factor controlling the master regulator of biofilm formation.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 44
structure length 169
sequence length 174
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2017-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...