5XJ0E

T. thermophilus rna polymerase holoenzyme bound with gp39 and gp76
Total Genus 19

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPVE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (3-6)TVIII1 (13-16)AH2 (16-32)TIV7 (76-79)AH3 (60-69)O1 (32-34)TIV2 (34-37)TVIII2 (38-41)AH4 (82-92)O2 (94-96)AH1 (6-12)TVIII3 (57-60)Updating...
connected with : NaN
molecule tags Transferase/transcription
source organism Thermus virus p23-45
publication title A Thermus phage protein inhibits host RNA polymerase by preventing template DNA strand loading during open promoter complex formation
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 19
structure length 95
sequence length 95
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2017-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.