5XKXA

Crystal structure of wt dddy
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
380
structure length
380
Chain Sequence
AQFQCQDDVKPTSYTTEEQKLVDQFWNESLIYLDQYLKALETPTGQCKDSAQATIQTYNSETGKMQTQCIMKYRDVELVAKHLKAVLAEPDKAKACFDPQKNYKAFPLYTPSAHVQNLSATSKWINRPLLTDYYKKIGGEIGAAGLELNENFLEITSRTDTTLHWTKDVSIKGLPTLWSSVGWIPFYAENPNAGSDRFRGGYLYAEVMGPWGNLRIKEIDGEKVGAEIGMTAQLFNTSYPYHYHHPQEIYMTLTKPQCIDQNKHMVMHWDNNQFKQKRSDNGWTVNIDGSKGKWKKWFSNQDPEQNWLTYFERNAIHAFHTLEGCNQTIKNSGLVTVWARTTAQDNNQTTQLCRPMTGAKDIKTMKPEDKAICDLDDWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uncharacterized protein
publication title Mechanistic Insights into Dimethylsulfoniopropionate Lyase DddY, a New Member of the Cupin Superfamily.
pubmed doi rcsb
source organism Acinetobacter bereziniae niph 3
total genus 130
structure length 380
sequence length 380
ec nomenclature
pdb deposition date 2017-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16867 DMSP_lyase Dimethlysulfonioproprionate lyase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...