5XOZA

Crystal structure of a kunitz type trypsin inhibitor from cicer arietinuml
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
178
structure length
178
Chain Sequence
VEQVLDINGNPIFPGGKYYILPAIRGPPGGGVRLDKTGDSECPVTVLQDYKEVINGLPVKFVIPGISPGIIFTGTPIEIEFTKKPNCAESSKWLIFVDDTIDKACIGIGGPENYSGKQTLSGTFNIQKYGSGFGYKLGFCVKGSPICLDIGRYDNDEGGRRLNLTEHEAFRVVFVDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Trypsin protein inhibitor 2
publication title Structural insights into the unique inhibitory mechanism of Kunitz type trypsin inhibitor from Cicer arietinum L.
pubmed doi rcsb
source organism Cicer arietinum
total genus 38
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2017-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...