5XSZA

Crystal structure of zebrafish lysophosphatidic acid receptor lpa6
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
454
structure length
448
Chain Sequence
DNFKYPLYSMVFSIVFMVGLITNVAAMYIFMCSLKLRNETTTYMMNLVVSDLLFVLTLPLRVFYFVQQNWPFGSLLCKLSVSLFYTNMYGSILFLTCISVDRFLAIVYPFRSRGLRTKRNAKIVCAAVWVLVLSGSLPTGFMLNSTNKLENNSISCFEWKSHLSKVVIFIETVGFLIPLMLNVVCSAMVLQTLRRPNTVNIFEMLRIDNGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLNKKKILRMIIVHLFIFCFCFIPYNVNLVFYSLVRTNTLKGCAAESVVRTIYPIALCIAVSNCCFDPIVYYFTSETIQNSASSEDLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Lysophosphatidic acid receptor 6a,Endolysin,Lysophosphatidic
publication title Structural insights into ligand recognition by the lysophosphatidic acid receptor LPA6
pubmed doi rcsb
source organism Danio rerio
total genus 153
structure length 448
sequence length 454
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2017-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...