5XTHK

Cryo-em structure of human respiratory supercomplex i1iii2iv1
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
33
structure length
33
Chain Sequence
LQHHDYSTYTFLDLNLELSKFRMPQPSSGRESP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
pubmed doi rcsb
molecule keywords NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondria
molecule tags Oxidoreductase/electron transport
total genus 3
structure length 33
sequence length 33
ec nomenclature
pdb deposition date 2017-06-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...