5XUYA

Crystal structure of atg101-atg13horma
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
185
structure length
180
Chain Sequence
NSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGSMELEIWCLEMNEKCDKEISYTVYNRLSLLLKSLLAITRVTPAYRLSRKQEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-terminal region of ATG101 bridges ULK1 and PtdIns3K complex in autophagy initiation.
pubmed doi rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Autophagy-related protein 13
total genus 40
structure length 180
sequence length 185
chains with identical sequence C
ec nomenclature
pdb deposition date 2017-06-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...