5XW2A

Crystal structure of the hydroxylase hmtn in c 1 2 1 crystal form
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
399
structure length
375
Chain Sequence
MTTPAERWGIHPEHFWLYGRRPRQMVEFDEKMNAWNVYGYAEAIEVLGDPGTFSSHMSRLLPMGAAFTEGDLLQTDPPDHRELRKLVSHAFTPKVVAELEPRITALTQELLDAVADRDTFDLMTALAYPLPVTVVAELLSIPSADRHLFEGWMTEIVHSLGAPMRKMLEYLREHAAECRRRPRGDLMGKLIEAERRLTDNHIVNFAKMLLIAGYLTTTMLIGNTVLCLDSYPEQAARVRADRSLIPGLLEESMRFLSPVAATYRATTRDVEVAGQRLSADQMVMVWFGAANRDARQFAEPELFDMTRGPNPHLGFGRGIHFCLGGPLARMEGRVALDHLLDRFPELYTDPERPPTFMPGFDTTGVSSLPLRTSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Cytochrome P450 107B1 (P450CVIIB1)
publication title Molecular characterization of the hydroxylase HmtN at 1.3 angstrom resolution.
pubmed doi rcsb
source organism Streptomyces himastatinicus atcc 53653
total genus 131
structure length 375
sequence length 399
ec nomenclature
pdb deposition date 2017-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00067 p450 Cytochrome P450
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...