5XYVC

Crystal structure of drosophila melanogaster rhino chromoshadow domain in complex with deadlock n-terminal domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
EKLDKIRMSQKLSCWQHILTTLGTSSKTEQEWNTFFKGFLESWRKPYCIQTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into Rhino-Deadlock complex for germline piRNA cluster specification
pubmed doi rcsb
molecule tags Protein binding
source organism Drosophila melanogaster
molecule keywords RHINO
total genus 13
structure length 52
sequence length 52
chains with identical sequence D
ec nomenclature
pdb deposition date 2017-07-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...