5Y32B

Crystal structure of ptp delta ig1-ig2 in complex with il1rapl1
Total Genus 60

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
322
structure length
322
Chain Sequence
CTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKAWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKR
5010015020025030030025020015010050
0102030405060Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (32-36)AH1 (64-70)S2 (41-44)TIV1 (44-47)TIV3 (56-59)EMPTYTI1 (54-57)S3 (49-52)TIV2 (53-56)TIV4 (81-84)S4 (73-79)TIV5 (93-96)S7 (114-121)TIV8 (105-108)3H1 (110-112)TIV13 (182-185)S11 (180-183)S8 (126-136)TI7 (197-200)TIV9 (122-125)TVIII2 (203-206)TI5 (168-171)TII1 (139-142)TI4 (167-170)TI3 (145-148)S9 (150-155)TII2 (155-158)S10 (160-163)TIV11 (164-167)S13 (200-203)TI'1 (183-186)TI6 (191-194)S19 (280-285)3H2 (208-210)S16 (243-246)S15 (223-234)TI8 (289-292)S20 (288-289)S22 (304-308)TIV18 (248-251)S17 (253-257)S18 (263-271)TIV21 (295-298)S21 (298-300)TII3 (258-261)TI9 (290-293)TIV19 (274-277)TIV20 (284-287)S23 (313-321)TIV23 (309-312)S6 (102-105)TIV12 (175-178)S12 (194-196)TIV22 (308-311)S5 (96-97)TIV7 (99-102)S14 (212-220)Updating...
connected with : NaN
molecule tags Immune system/hydrolase
source organism Mus musculus
publication title Mechanisms of splicing-dependent trans-synaptic adhesion by PTP delta-IL1RAPL1/IL-1RAcP for synaptic differentiation.
pubmed doi rcsb
molecule keywords Interleukin-1 receptor accessory protein-like 1
total genus 60
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2017-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00047 ig Immunoglobulin domain
B PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.