5YB5B

The complex crystal structure of vreh2 mutant m263n with sno
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
318
structure length
318
Chain Sequence
MEEIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYRAVAPDLRGYGDTEAPVSISSYTGFHIVGDLIALIDLLGVDQVFLVAHDWGAIIGWYLCTFHPDRVKAYVCLSVPLLHRDPNIRTVDAMRAMYGDDYYICRFQKPGEMEAQMAEVGTEYVLKNILTTRKPGPPIFPKGEYGTGFNPDMPNSLPSWLTQDDLAYYVSKYEKTGFTGPLNYYRNMNLNWELTAPWSGGKIQVPVKFITGELDNVYTSLNMKEYIHGGGFKQDVPNLEEVIVQKNVAHFNNQEAAEEINNHIYDFIKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Epoxide hydrolase
publication title Regioselectivity Engineering of Epoxide Hydrolase: Near-Perfect Enantioconvergence through a Single Site Mutation
doi rcsb
source organism Vigna radiata
total genus 127
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2017-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...