5YCFA

Crystal structure of xiphophorus maculatus adenylate kinase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
189
structure length
189
Chain Sequence
IKDAKIIFVVGGPGSGKGTQCEKIVAKYGYTHLSSGDLLRAEVASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYVDAKAETMVKRLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYEGRGIVKKVDSELAVDDVFAQVSKAIDAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Xiphophorus maculatus adenylate kinase
rcsb
molecule keywords Adenylate kinase isoenzyme 1
molecule tags Transferase
source organism Xiphophorus maculatus
total genus 71
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2017-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...