5YH4A

Miraculin-like protein from vitis vinifera
Total Genus 38
204060801001201401600510152025303540
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
179
structure length
179
Chain Sequence
ESAPDPVLDTEGKQLRSGVDYYILPVIRGRGGGLTLASTGNENCPLDVVQEQHEVSNGLPLTFTPVNPKKGVIRVSTDHNIKFSASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDVPFKVMFKKA

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS9 (134-139)TI1 (9-12)S12 (173-178)S1 (21-25)TII1 (16-19)S4 (61-65)S2 (33-37)TVIII1 (25-28)TI2 (53-56)TIV4 (158-161)S7 (105-109)TIV1 (43-46)S11 (162-167)S3 (47-51)S5 (77-83)TVIII2 (65-68)TIV2 (67-70)TIV3 (74-77)TVIII3 (142-145)S6 (96-100)TI5 (121-124)TI4 (101-104)TI3 (100-103)3H1 (119-121)TI6 (122-125)TII'1 (131-134)TI7 (144-147)S10 (152-159)TVIII4 (168-171)S8 (126-131)Updating...
connected with : NaN
molecule tags Hydrolase inhibitor
source organism Vitis vinifera
publication title Structural and functional analysis of miraculin-like protein from Vitis vinifera.
pubmed doi rcsb
molecule keywords mirauclin-like protein
total genus 38
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2017-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.