5YJ7A

Structural insight into the beta-gh1 glucosidase bgln1 from oleaginous microalgae nannochloropsis
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
483
structure length
483
Chain Sequence
DVTCWKYAIPGEPGGELTAEEVFASKDTAFPEGFLWGAATAAYQIEGAAAEDGRGPSMWDTFSKIPGKIDNGDTGDVACDHYHRYKEDVKLMKGMGLKSYRFSVSWSRVLPEGTGAINPKGMEFYQNLTNELIANGIVPTVTLYHWDLPEALSKNGGWLNEDTAVAFGQYADVMFQALGDRVKLWFTLNEPWTTAIAGYGQGGHAPGLKNMAENPYMAGHNQLLGHAAAVKVYREKYQEKQGGKIGAVLSTEWKEPLCHTQEDKDAAERSLIWYLAWFADPIYKGDYPEEMKERVGDRMPAFTEQQKQDLKGSADFFGINHYATNLLQGPTEKIGAENYFSDLNGWIMMDPRWAVGDASWLSVVPWGMRRLLRWIKHRYDDPVVYVTENGLSVPNESAMTPEAALNDKMRVDYLQGYVAEMWKAINYDKVKVAGYYHWSLLDNFEWSDGYKVRFGLVQVDYKTQKRTLKESAKVYKDMIAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into the beta-GH1 glucosidase BGLN1 from oleaginous microalgae Nannochloropsis
rcsb
molecule tags Hydrolase
source organism Nannochloris
molecule keywords Glycoside hydrolase
total genus 191
structure length 483
sequence length 483
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2017-10-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...