5YT6B

Crystal structure of tax1bp1 ubz2 in complex with mono-ubiquitin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
35
structure length
35
Chain Sequence
SWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanistic Insights into Recognitions of Ubiquitin and Myosin VI by Autophagy Receptor TAX1BP1.
pubmed doi rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Ubiquitin
total genus 10
structure length 35
sequence length 35
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2017-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...