5YUQA

The high resolution structure of chitinase (rmchi1) from the thermophilic fungus rhizomucor miehei (sp p1)
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
370
structure length
370
Chain Sequence
GQKLSAYVVDWDLPKSIAWDKLDHIVYAFAEPTKDGELSGFTDSQLKSVVQEAHSRGKSISLSVGGWTGSLYFSDLLKSSSSFDNFVSNLVDVVKEYDLDGLNLDWEYPNSPNGVACNSKDENDTANYLKLFKALREKLGSKTILTTAVPTAPFNDENQQPSTKLDDNWASTVDAFYIMAYDVNGIRDKNAGANAPLYYSPKVTGVEPTSGNDAVKAWIAAGIPAEQLVLGVPFYGRVSKTLEPITASTGLYVPISQSSQIKGDSTDEKAADPCPNAVATYSGQYIWRTIAQEGIARNSSGWVTYWDDISKTPYAYSFSGSKVLSFDDAASLQDKVDYAKKQGLGGVMLWSLEMDDDENTLLNALQDIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high resolution structure of chitinase (RmChi1) from the thermophilic fungus Rhizomucor miehei (sp P1)
rcsb
molecule keywords Chintase
molecule tags Hydrolase
source organism Rhizomucor miehei
total genus 131
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2017-11-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...