5Z0QA

Crystal structure of ovob
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
376
structure length
376
Chain Sequence
FNFDQRIDRRHSDSLKWKKYADRDILPLWIADTDFRAADCIIDALQQRVQQGVFGYGVTSEALAEVAIERMESRFGWKIQPEWLVFLPGVVTGINIAVRAFTEAHQSTVSATPIYPPFFLAPKLAGRQHLSAALRLEQQRWVLDLDSHEDRMSGNEKLLLLCNPHNPGGTVYRRKELEAQLRFAQRHDLLVCSDEIHCDLVLEPGVQHIPFASLSDDAAQRSITLMSPSKSFNIAGLGASLAVIPNPELRARFNRMRKGMVPDVDVLAYVAASAAWREGQPWLDAQLDYLRANRDMLAQHVNRLPGLSMVTPEASFLGWIDASGLGVADPALFFEKHGLGFSSGRDFGNDRFVRFNFGCPRQLLEEALQRMTRALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In Vitro Reconstitution of the Remaining Steps in Ovothiol A Biosynthesis: C-S Lyase and Methyltransferase Reactions.
pubmed doi rcsb
molecule keywords Aminotransferase, class I and II
molecule tags Transferase
source organism Erwinia tasmaniensis (strain dsm 17950 / cip 109463 / et1/99)
total genus 117
structure length 376
sequence length 376
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2017-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...