5Z1NA

Crystal structure of c terminal region of g-protein interacting protein 1 (gip1) from dictyostelium discoideum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
166
structure length
166
Chain Sequence
LSGLKKLIPEEGRELIGSVKKIIKRVSNEEKANEMEKNILKILIKVFFYIDSKAIQIGDLAKVDRALRDGFNHLDRAFRYYGVKKAADLVVILEKASTALKEAEQETVTLLTPFFRPHNIQLIRNTFAFLGSLDFFTKVWDDLEIEDDLFLLISALNKYTQIELIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Gip1 for cytosolic sequestration of G protein in wide-range chemotaxis
pubmed doi rcsb
molecule tags Protein binding
source organism Dictyostelium discoideum
molecule keywords G-protein interacting protein 1
total genus 70
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2017-12-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...