5Z5MA

Crystal structure of (s)-allantoin synthase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
295
structure length
273
Chain Sequence
VTVKDLLSKPSAEIASFLGGIYEHSAWVAEALVKDAESLASIETISQLAAAMKAIVNKSSKDQKLELLCAHPDLCQSLTDAELERFNSLNGAYRDQCGFPFILAVRNATKHTVLAALGGRVQHTPEQEFMVALEQVHKIAWMRLLSKIDTSDAQGFLTCHVLDTGNGCPAEKMRIHLHRLSPPEMAGLVGEFVTNDDGRLEGGPALKGGKEFTVGQYEWTFFCGEYFASKGTFTSGQPFLDTIPLRFGIDNPDDHYHVPLLVSPWSFSTYRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Predicted protein
publication title Diatom Allantoin Synthase Provides Structural Insights into Natural Fusion Protein Therapeutics.
pubmed doi rcsb
source organism Phaeodactylum tricornutum ccap 1055/1
total genus 84
structure length 273
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2018-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
A PF09349 OHCU_decarbox OHCU decarboxylase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...