5ZABA

Crystal structure of cf3-aequorin
Total Genus 72
20406080100120140160180010203040506070
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
191
structure length
191
Chain Sequence
HHGKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
2040608010012014016018015010050
010203040506070Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI1 (6-9)TI5 (177-180)AH1 (10-23)TI2 (24-27)AH2 (33-48)AH4 (79-99)S2 (76-78)TVIII1 (137-140)AH3 (52-69)TII1 (72-75)AH5 (104-116)AH8 (162-175)S3 (123-124)TI3 (117-120)AH6 (126-136)AH7 (142-152)TIV1 (185-188)TI7 (182-185)TI4 (155-158)S4 (160-161)TII2 (180-183)TII'1 (184-187)TI6 (178-181)S1 (30-32)Updating...
connected with : NaN
molecule tags Luminescent protein
source organism Aequorea victoria
publication title Slow luminescence kinetics of semi-synthetic aequorin: expression, purification and structure determination of cf3-aequorin.
pubmed doi rcsb
molecule keywords Aequorin-2
total genus 72
structure length 191
sequence length 191
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2018-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.