5ZCIA

Crystal structure of apo form of xylose reductase from debaryomyces nepalensis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
320
structure length
320
Chain Sequence
MSIKLNSGYEMPLVGFGCWKVDNATCADTVYNAIKVGYRLFDAAMDYGNCKEIGEGINRALDEGLVARDELFITSKLWNSYHDPKNVELALKKVLSDMKLDYIDLFLIHFPIAFKFVPFEEKYPPAFYCGDGDNFHYEDVPLLETWKAMEKLTKGGKAKSIGISNFSAALIYDLLRGAEIKPAVLQIEHHPYLQQPRLIEYVQSQGIAITAYSSFGPQSFLELKHSKALDTPTLFEHKTITSIADKYKKTPAQVLLRWASQRDIAIIPKSNNPDRLLQNLEVNDFNLSKEDFDEISKLDQDLRFNNPWDWDTKNRIPIFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast xylose reductase in complex with a novel NADP-DTT adduct provides insights into substrate recognition and catalysis.
pubmed doi rcsb
molecule tags Oxidoreductase
source organism Debaryomyces nepalensis
molecule keywords Aldose reductase
total genus 101
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2018-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...