5ZJ3A

Textilinin-1, a kunitz-type serine protease inhibitor from pichia expression system
Total Genus 11

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
RPDFCELPADTGPCRVRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCA

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
3H1 (5-8)TIV1 (43-46)EMPTYS1 (20-26)AH1 (50-57)S2 (31-37)TI1 (26-29)Updating...
connected with : NaN
molecule tags Hydrolase inhibitor
source organism Pseudonaja textilis textilis
publication title Textilinin-1, A Kunitz-Type Serine Protease Inhibitor expressed from picha system by LIAONING GRAND NUOKANG BIOPHARMACEUTICAL CO.,LTD
rcsb
molecule keywords Kunitz-type serine protease inhibitor textilinin-1
total genus 11
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2018-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.