5ZWPA

Crystal structure of the delta-class glutathione transferase from musca domestica
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
207
structure length
207
Chain Sequence
MDFYYLPGSAPCRSVLMTAKALGIELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDGDFALWESRAIMVYLVEKYGKTDSLFPKCPKKRAVINQRLYFDMGTLYKSFADYYYPQIFAKAPADPELFKKIETAFDFLNTFLKGHEYAAGDSLTVADLALLASVSTFEVASFDISKYPNVAKWYANLKTVAPGWEENWAGCLEFKKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the delta-class glutathione transferase in Musca domestica
pubmed doi rcsb
molecule keywords Glutathione S-transferase 1
molecule tags Transferase
source organism Musca domestica
total genus 79
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2018-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...