6EQ5A

Mth1 in complex with fragment 4
Total Genus 36

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
155
structure length
155
Chain Sequence
GASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
2040608010012014014012010080604020
05101520253035Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (4-14)S4 (35-38)S2 (17-23)TI1 (14-17)S3 (31-33)TII1 (26-29)TII2 (28-31)TI2 (98-101)TIV2 (139-142)3H1 (113-115)TII3 (40-43)S8 (91-92)S5 (60-61)S6 (65-74)TII4 (74-77)S7 (80-88)S9 (101-107)TI3 (107-110)O1 (111-113)TIV1 (108-111)S11 (144-153)S10 (132-140)TI4 (141-144)AH1 (45-57)AH2 (119-129)Updating...
connected with : NaN
publication title Ligand retargeting by binding site analogy.
pubmed doi rcsb
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
molecule tags Hydrolase
source organism Homo sapiens
total genus 36
structure length 155
sequence length 155
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2017-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.