6ILIA

Crystal structure of human mth1(g2k/d120n mutant) in complex with 8-oxo-dgtp at ph 6.5
Total Genus 41
204060801001201400510152025303540
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
MKASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDNSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TI1 (14-17)TI3 (107-110)EMPTYS2 (17-23)TII2 (28-31)TII1 (26-29)S3 (31-33)TIV2 (139-142)TII'1 (140-143)3H1 (113-115)TII3 (40-43)AH1 (45-57)S5 (64-74)S8 (132-140)TII4 (74-77)S6 (77-88)S7 (101-107)TI2 (98-101)TIV1 (108-111)O1 (111-113)S1 (4-14)S4 (35-38)AH2 (119-129)S9 (144-153)Updating...
connected with : NaN
publication title Structural and Kinetic Studies of the Human Nudix Hydrolase MTH1 Reveal the Mechanism for Its Broad Substrate Specificity
pubmed doi rcsb
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
molecule tags Hydrolase
source organism Homo sapiens
total genus 41
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2018-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.