6LOIA

Crystal structure of enterococcus faecalis undecaprenyl pyrophosphate synthase(efaupps)
Total Genus 75

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
235
structure length
217
Chain Sequence
YAFDKEGQIPQHIAIIMDGNGRWAQNRRLPRIAGHKEGMDTVKKITKHASHLGVKVLTLYAFPVDFFDTFVPELIKENVKVNVMGYQEFLPSHTQDAVKRAIEQTKDNTGMVLNFALNYGARAELLTAMKQIAAEVSEKAYTADEITEETIADHLMTGFLPTELRDPELLIRTSGEERISNFLLWQIAYSELFFTKALWPDFSGDTLETAIASFQNR

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TI1 (15-18)TIV2 (168-171)EMPTYS5 (198-201)TI3 (171-174)TVIII1 (21-24)AH1 (31-38)S1 (23-28)AH2 (42-63)TIV3 (208-211)3H1 (116-118)AH3 (94-106)S2 (67-72)AH6 (177-183)AH4 (121-134)AH5 (150-167)TI5 (184-187)S4 (141-146)TI2 (134-137)TI7 (190-193)TVIII3 (193-196)TVIII4 (196-199)TI4 (172-175)TI'1 (202-205)TI11 (214-217)TIV4 (210-213)TI10 (213-216)TI9 (212-215)TVIII2 (65-68)TIV1 (145-148)S3 (109-114)Updating...
connected with : NaN
publication title Investigations into the Antibacterial Mechanism of Action of Viridicatumtoxins.
pubmed doi rcsb
molecule keywords Isoprenyl transferase
molecule tags Transferase
source organism Enterococcus faecalis
total genus 75
structure length 217
sequence length 235
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.-:
pdb deposition date 2020-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01255 Prenyltransf Putative undecaprenyl diphosphate synthase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.