6NCHA

Crystal structure of cdp-chase: raster data collection
Total Genus 65
204060801001201401601802000102030405060
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
204
structure length
204
Chain Sequence
TIKWIDWVKQIQSIAQAGLTYSKDVYDIERFQQLRDISISMMSHYTKTDWEVVEKLFASETGYQTPKVDIRAVVFQNEKLLFVKEKSDGKWALPGGWADVGYTPTEVAAKEVFEETGYEVDHFKLLAIFDKEKHQPSPSATHVYKIFIGCEIIGGEKKTSIETEEVEFFGENELPNLSIARNTEDQIKEMFAYMKDPQKEKLID

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (4-22)TI2 (131-134)EMPTYS7 (144-156)S1 (68-74)S4 (92-93)S3 (80-86)S2 (76-77)TIV1 (76-79)TIV2 (86-89)TI1 (87-90)TI3 (161-164)TI5 (179-182)TII1 (100-103)AH4 (105-117)S6 (119-131)TIV3 (133-136)S9 (203-204)S8 (164-170)TI4 (171-174)AH5 (185-196)TI7 (197-200)AH2 (26-47)TVIII1 (140-143)S5 (96-98)TI6 (180-183)AH3 (51-59)Updating...
connected with : NaN
publication title Getting the most out of your crystals: Data collection at the new high-flux, microfocus MX beamlines at NSLS-II
doi rcsb
molecule keywords Phosphohydrolase (MutT/nudix family protein)
molecule tags Hydrolase
source organism Bacillus cereus (strain atcc 14579 / dsm 31 / jcm 2152 / nbrc 15305 / ncimb 9373
total genus 65
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
A PF12535 Nudix_N Hydrolase of X-linked nucleoside diphosphate N terminal
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.