6PCKA

Crystal structure of human diphosphoinositol polyphosphate phosphohydrolase 1 in complex with 1-ip7
Total Genus 36

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
134
structure length
134
Chain Sequence
TRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFET

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TI1 (13-16)TVIII1 (40-43)S5 (73-86)EMPTYTI6 (87-90)S1 (18-26)S6 (91-103)AH1 (59-71)AH2 (108-113)TI2 (28-31)TI3 (39-42)TVIII2 (104-107)S2 (33-38)AH3 (122-130)TI4 (42-45)TII1 (54-57)S3 (46-47)S7 (117-121)TI5 (86-89)S4 (50-52)TI7 (130-133)Updating...
connected with : NaN
molecule tags Hydrolase
source organism Homo sapiens
publication title Vip1 is a kinase and pyrophosphatase switch that regulates inositol diphosphate signaling.
pubmed doi rcsb
molecule keywords Diphosphoinositol polyphosphate phosphohydrolase 1
total genus 36
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2019-06-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.