6Y3ZA

Crystal structure of the pby1 atp-grasp enzyme bound to the s. cerevisiae mrna decapping complex (dcp1-dcp2-edc3)
Total Genus 64

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
253
structure length
243
Chain Sequence
SVDRILEDLLVRFIINCPNERELFHFEEASWFYTDFIKLMNPTLPSLKIKSFAQLIIKLCPLVWKWDIRVDEALQQFSKYKKSIPVRGAAIFNENLSKILLVQGTESDSWSFPRGSKDENDIDCCIREVKEEIGFDLTDYIDDNQFIERNIQGKNYKIFLISGVSEVFNFKPQVRNEIDKIEWFDFKKISKTMYNIKYYLINSMMRPLSMWLRHQRQIKNEDQLKSYAEEQLKLLLGITKEEQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH2 (40-59)TI1 (60-63)EMPTYTI2 (79-82)TI3 (80-83)TI6 (158-161)AH4 (89-100)TI4 (112-115)TI9 (186-189)S6 (175-185)O1 (100-102)S1 (104-112)S7 (199-206)TI5 (123-126)S2 (117-123)S3 (129-130)S4 (133-134)S5 (167-172)TIV2 (137-140)AH5 (142-154)TIV3 (171-174)TVIII1 (193-196)TI10 (195-198)AH7 (228-257)TIV1 (30-33)3H1 (224-226)TIV7 (221-224)TI8 (163-166)AH6 (207-214)AH1 (15-30)AH3 (68-78)Updating...
connected with : NaN
molecule tags Hydrolase
source organism Saccharomyces cerevisiae s288c
publication title Pby1 is a direct partner of the Dcp2 decapping enzyme
doi rcsb
molecule keywords m7GpppN-mRNA hydrolase
total genus 64
structure length 243
sequence length 253
ec nomenclature
pdb deposition date 2020-02-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.