6YLZAAA

X-ray structure of the k72i,y129f,r133l, h199a quadruple mutant of pnp-oxidase from e. coli
Total Genus 57

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
212
structure length
212
Chain Sequence
LQQIAHLRREYTKGGLRRRDLPADPLTLFERWLSQACEAKLADPTAMVVATVDEHGQPYQRIVLLIHYDEKGMVFYTNLGSRKAHQIENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKFFHSLPRDSQIGAWVSKQSSRISARGILESKFLELKQKFQQGEVPLPSFWGGFRVSLEQIEFWQGGEHRLADRFLYQRENDAWKIDRLAP

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (7-18)TVIII2 (185-188)TIV2 (206-209)S8 (200-207)3H1 (24-26)EMPTYAH2 (31-45)S2 (64-75)TI2 (59-62)TIV1 (47-50)AH3 (88-95)S3 (78-84)TI3 (75-78)AH5 (135-142)3H2 (106-108)S4 (98-105)S7 (187-192)S6 (178-183)AH4 (123-131)AH6 (153-167)TI5 (167-170)3H3 (195-197)TVIII1 (28-31)TI1 (49-52)TI6 (175-178)S5 (110-120)S9 (210-215)TI4 (84-87)S1 (52-58)TII1 (145-148)Updating...
connected with : NaN
molecule tags Flavoprotein
source organism Escherichia coli
publication title X-ray structure of the K72I,Y129F,R133L, H199A quadruple mutant of PNP-oxidase from E. coli
rcsb
molecule keywords Pyridoxine/pyridoxamine 5'-phosphate oxidase
total genus 57
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2020-04-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.