6AH3G

Cryo-em structure of yeast ribonuclease p with pre-trna substrate
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
128
structure length
121
Chain Sequence
KRVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSYVAVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVITEGSDVEDDDKETQLKKRAVSGVELRIYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Ribonuclease P RNA
publication title Structural insight into precursor tRNA processing by yeast ribonuclease P.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 20
structure length 121
sequence length 128
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2018-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF12328 Rpp20 Rpp20 subunit of nuclear RNase MRP and P
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...