6AKLA

Crystal structure of striatin3 in complex with sike1 coiled-coil domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
52
structure length
52
Chain Sequence
STMALLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architecture, substructures, and dynamic assembly of STRIPAK complexes in Hippo signaling.
pubmed doi rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Suppressor of IKBKE 1
total genus 22
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-09-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...