6AL3A

Lys49 pla2 bpii derived from the venom of protobothrops flavoviridis.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
SLVQLWKMIFQETGKEAAKNYGLYGCNCGVGRRGKPKDATDSCCYVHKCCYKKVTGCNPKMDSYSYSWKNKAIVCGEKNPPCLKQVCECDKAVAICLRENLGTYNKKYTIYPKPFCKKADTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SDS-induced oligomerization of Lys49-phospholipase A2from snake venom.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Basic phospholipase A2 BP-II
total genus 39
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.4: Phospholipase A(2).
pdb deposition date 2018-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00068 Phospholip_A2_1 Phospholipase A2
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...