6AZ1U

Cryo-em structure of the small subunit of leishmania ribosome bound to paromomycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
156
structure length
156
Chain Sequence
PQYYHAHQVDATIQHQKAYQRQTAVNENMHRSSRKHVNKSGHIRYAKKIGLGFKTPAKALNGKYIDRKCPFTSNVVIRGRILRGIVHSTKMHRTIVIRRNYLHFIKKYQRYQKRHKSLAVHCSPAFDPKQGDEVVVGQCRPLSKTIRYNVLEVVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords Ribosomal protein s1e
publication title Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.
pubmed doi rcsb
total genus 19
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2017-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00366 Ribosomal_S17 Ribosomal protein S17
U PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...