6BG8A

Shewanella frigidimarina ice-binding protein_1 duf3494 domain
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
239
structure length
239
Chain Sequence
MNPLAPELGEVARFAMLASQAITTTSGSAIVDGDLGILDQARSYYAGFTPGVNAGEFDELTNGLSYAGDDSTPPYVVPVPYASMVAFINQSRTDLGIAYNFLAADPNPNAATQVCPIELGNLTLTRGVYKTAADVTLQTGTLTLDGEGDPDSVFIFTIGGNLTSGAPGGDIVLINGAQAKNIYWRTAGKTVIGTNTNFSGNVFAWSEVNVRTGANVTGRLFAVTDQVTLDANAVTKANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifreeze protein
molecule keywords Ig domain protein, group 2 domain protein
publication title An ice-binding and tandem beta-sandwich domain-containing protein in Shewanella frigidimarina is a potential new type of ice adhesin.
pubmed doi rcsb
source organism Shewanella frigidimarina (strain ncimb 400)
total genus 88
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2017-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11999 DUF3494 Protein of unknown function (DUF3494)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...