6BK8H

S. cerevisiae spliceosomal post-catalytic p complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
174
structure length
70
Chain Sequence
TTSHRPQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKSWRKGTAFGRYINDMTKSEYHQEFLHKHVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U2 snRNA
publication title Structure of the yeast spliceosomal postcatalytic P complex.
pubmed doi rcsb
total genus 5
structure length 70
sequence length 174
ec nomenclature
pdb deposition date 2017-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF04889 Cwf_Cwc_15 Cwf15/Cwc15 cell cycle control protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...