6BM9A

Directed evolutionary changes in mbl super family - vim-2 round 10
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
228
Chain Sequence
SREYPTASEIPDGEVRLYQIADGVWSHIAAQPAYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAKVEGTEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSPDNLIVYVPSARVLYGGCAIYELSRTSAGNVAAADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTSDVVKAHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryptic genetic variation shapes the adaptive evolutionary potential of enzymes.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase
total genus 55
structure length 228
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2017-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...