6C16A

Ubiquitin variant (ubv.fbl10.1) bound to a human skp1-fbl11 fragment complex.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
156
structure length
134
Chain Sequence
AMPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDDDPVPLPNVNAAILKKVIQWCTHHKDDPPTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNDFTEEEEAQVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structure-Based Strategy for Engineering Selective Ubiquitin Variant Inhibitors of Skp1-Cul1-F-Box Ubiquitin Ligases.
pubmed doi rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords S-phase kinase-associated protein 1
total genus 31
structure length 134
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01466 Skp1 Skp1 family, dimerisation domain
A PF03931 Skp1_POZ Skp1 family, tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...