6C1ZA

Crystal structure of apo caenorhabditis elegans lipid binding protein 8 (lbp-8)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
138
Chain Sequence
AMVSMKEFIGRWKLVHSENFEEYLKEIGVGLLIRKAASLTSPTLEIKLDGDTWHFNQYSTFKNNKLAFKIREKFVEIAPDERSYNTLVTFENGKFISHQDKIKENHHSSVFTTWLENGKLLQTYQSGSVICRREFVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Lipid Binding Protein
publication title Elucidating the Mechanism of Lipid Binding Protein 8 Shuttling of Lysosomal Lipids into the Nucleus in Caenorhabditis Elegans to Increase Lifespan.
rcsb
source organism Caenorhabditis elegans
total genus 30
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2018-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...