6C3DA

O2-, plp-dependent l-arginine hydroxylase rohp quinonoid ii complex
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
377
structure length
377
Chain Sequence
LDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEAEEGLQATYEKRFTEAFFQLHRQPTALVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPIDESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLLRHGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVRDSAADRLASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAWFRVDHPELTATDVHRLLSADGVYVLPGRYFYWSEPSKGDAYVRMALAREPEMFADAMALTRQVLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the Catalytic Cycle of an O2, Pyridoxal Phosphate-Dependent Hydroxylase.
pubmed doi rcsb
molecule tags Biosynthetic protein
source organism Streptomyces cattleya (strain atcc 35852 / dsm 46488 / jcm 4925 / nbrc 14057 / n
molecule keywords Uncharacterized protein
total genus 148
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...