6C4UA

Engineered fha with myc-ptbd peptide
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
ENIVFRVISTTGQIPIRDFSADISQVLKEKRSIKKVWTFGRNPACDYHLGNILPVSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSYQLLSQGDEITVRTDPTGTILSLVIFINDKFKQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generating a recombinant phosphothreonine-binding domain for a phosphopeptide of the human transcription factor, c-Myc.
pubmed doi rcsb
molecule keywords Forkhead-associated 1
molecule tags Peptide binding protein
source organism Saccharomyces cerevisiae
total genus 29
structure length 127
sequence length 127
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2018-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...