6C5XA

Crystal structure of socs1 in complex with elonginb and elonginc
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
151
Chain Sequence
RSHSDFTVITKTSSMLDTCGFYWGPMDVNVAHDKLKSEPIGTFLIRDSKQKNCFFAISVKTARETVSIRIKFHAGKFSLDKELFSCLFQLVEHYMTSPKKMLVSPLRKVRLRPLQELCRKSILATFGRQNLDSIPLNRVLKDYLKSFPFQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis of JAK/STAT inhibition by SOCS1.
pubmed doi rcsb
molecule keywords Elongin-B
molecule tags Signaling protein
source organism Homo sapiens
total genus 34
structure length 151
sequence length 153
chains with identical sequence D
ec nomenclature
pdb deposition date 2018-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07525 SOCS_box SOCS box
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...