6CXMA

Crystal structure of a dihydrofolate reductase from mycobacterium smegmatis in complex with nadp and p218
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
155
Chain Sequence
SMRLIWAQSTSGIIGRDNSIPWRLPEDLARFKEMTMGHPVVMGRLTWESLPASVRPLPGRRNIVVTRDADYRAEGAEVVTDLPDEPDAWVIGGAQIYAMALARADRCEVTEVDIALTPLDGDARAPVLDDSWVATTGEWQTSTSGLRFRFCSYRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a dihydrofolate reductase from Mycobacterium smegmatis in complex with NADP and P218
rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase/inhibitor
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
total genus 38
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2018-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...