6CZNA

Estrogen receptor alpha ligand binding domain y537s mutant in complex with z2ohtpe and a glucocorticoid receptor-interacting protein 1 nr box ii peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
241
structure length
212
Chain Sequence
LSLTADQMVSALLDAEPPILYSSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNKEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear protein
molecule keywords Estrogen receptor
publication title Estrogen Receptor Alpha Ligand Binding Domain Y537S Mutant in Complex with Z2OHTPE and a glucocorticoid receptor-interacting protein 1 NR box II peptide
rcsb
source organism Homo sapiens
total genus 72
structure length 212
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...