6DCCA

Structure of methylphosphate capping enzyme methyltransferase domain in complex with 5' end of 7sk rna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
221
Chain Sequence
KFQYGNYCKYYGYRNPSCEDGRLRVLKPEWFRGRDVLDLGCNVGHLTLSIACKWGPSRMVGLDIDSRLIHSARQNIRHYLSVFPNNVVFVTGNYVLDRDDLVEAQTPEYDVVLCLSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYGKRKTLTETIYKNYYRIQLKPEQFSSYLTSPDVGFSSYELVATPHNTSKGFQRPVYLFHKARSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of 7SK RNA 5'-gamma-phosphate methylation and retention by MePCE.
pubmed doi rcsb
molecule keywords 7SK snRNA methylphosphate capping enzyme
molecule tags Transferase/rna
source organism Homo sapiens
total genus 69
structure length 221
sequence length 276
ec nomenclature ec 2.1.1.-:
pdb deposition date 2018-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06859 Bin3 Bicoid-interacting protein 3 (Bin3)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...